3-MCPD - PDFSEARCH.IO - Document Search Engine

3-MCPD
Results: 71

#	Item
51	TSCOOP[removed]Table of methods used to calc 3-MCPD consumption Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 13:59:39 Food science Health sciences Self-care Food Diet Health Medicine Nutrition
52	ANNEX 5 Tables Table 1: Summary of collated occurrence data for chloropropanols in soy sauce and soy sauce based products (group[removed]) Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 13:59:39 Carcinogens Diols Organochlorides Soy products Soy sauce Oyster sauce Soybean Sauce Food and drink Philippine cuisine 3-MCPD
53	Table 24: Data for occurrence of 3-MCPD in individual soy sauce samples Food code level 1* Food code Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 13:59:40 Japanese cuisine Vietnamese cuisine Fermented foods Soy sauce 3-MCPD Soybean Sauce Food and drink Philippine cuisine Soy products
54	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate C - Scientific Opinions &0DQDJHPHQWRIVFLHQWLILFFRPPLWWHHVVFLHQWLILFFRRSHUDWLRQDQGQHWZRUNV 6FLHQWLILF&RPPLWWHHRQ)RRG Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:31:57 1 3-Propanediol Propylene glycol Micronucleus test Diols Chemistry 3-MCPD
55	Table 32: Data for occurrence of 3-MCPD in individual ingredient samples Level of chloropropanol (mg/kg) Ingredient Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 13:59:39 Malt 3-MCPD Brewing Hydrolysis Caramel color Food and drink Chemistry Acid-hydrolyzed vegetable protein
56	Table 28: Data for occurrence of 3-MCPD in individual food samples Food code level 1* 1 1 Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 13:59:39 Noodles Noodle soup Cheese Noodle Processed cheese Cheddar cheese Milk Food and drink Instant noodles Japanese cuisine
57	[removed]European Community comments for the CODEX COMMITTEE ON CONTAMINANTS IN FOOD 1st session, Beijing, China, 16-20 April 2007 Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:44:55 Diols Organochlorides Philippine cuisine Soy sauce Soybean Acid-hydrolyzed vegetable protein Food and drink 3-MCPD Carcinogens
58	ILSI Europe Report Series 3-MCPD Esters in Food Products Summary Report of a Workshop held in February 2009 Add to Reading List Source URL: www.ilsi.org Language: English - Date: 2010-03-01 03:27:13 3-MCPD Carcinogens Diols Organochlorides International Life Sciences Institute Soy sauce Fatty acid ester Glycidol Ester Food and drink Chemistry Organic chemistry
59	[removed]EUROPEAN COMMUNITY COMMON POSITION CODEX COMMITTEE ON PROCESSED FRUITS AND VEGETABLES 22nd Session Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:47:44 Food science Soil contamination Food law 3-MCPD Codex Alimentarius Soy sauce Soybean Food additive Food contaminant Food and drink Food safety Pesticides
60	TSCOOP[removed]Table of methods used to calc 3-MCPD consumption Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 13:59:37 Food science Health sciences Self-care Food Diet Health Medicine Nutrition